PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113091001
Common NameGSBRNA2T00113091001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 594aa    MW: 66758.9 Da    PI: 4.988
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113091001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like431e-13205254454
              G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                           +Wt + H +F+ a++ L G+++  Pk+ile+mk   L+  +v S LQkY+
  GSBRNA2T00113091001 205 NVWTRDRHMKFLAAISIL-GEKESRPKAILEIMKDSNLSQRQVGSYLQKYK 254
                          58****************.999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011017.07619131IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.2E-620125IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23006.7E-920151No hitNo description
SuperFamilySSF521726.64E-920166IPR011006CheY-like superfamily
TIGRFAMsTIGR015571.6E-12205254IPR006447Myb domain, plants
SuperFamilySSF466897.53E-9205256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-14205257IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MAENMVNLTK NIIPESTGVI LLIDHDAISV ASLIPMLKQR SHKDVMSVNG ASEAISVIEK  60
QKDIGLVIAN VELSDTNDFL TAMHHKEIPL ILIGTEIHIK ETSDLLTKRA CSCLKKPISE  120
NDVDNMFQLV LPNKRQEWEK INVAEKRENI VEERMKQMKA FRDHIKRQGT SQSSLLGRRP  180
LNKTFTSSQM YQKGKSIADV EGCKNVWTRD RHMKFLAAIS ILGEKESRPK AILEIMKDSN  240
LSQRQVGSYL QKYKFQVEII NKTLTRNEWK STDKTYEYPS DYVYPFKASN LAKTLIESNS  300
MWCSLRKRKS SSLSTVQYSF KRSAAEKKDR MPKFHIGEKS GLHRHSLSGS RVGASNLDAF  360
QKESAKICIS QSNPNPSQPS SYVLETNKNP LDMNQMGRVS FGENHGLSQD MIFNGTKSNH  420
LGLVSGETSH IETPLETDTN QMDWDWFSSD EAYAILEDLT VPETNINQVG LVPGETSFAA  480
LDNVTPPENN TNEIGLVPNQ EGNDDIPIED LISFGTDIIN EMDDLDAWLE NYNSFQGDVP  540
LPASCNDHDL AFTPTTSQHQ NIEAANPREA TEEGNHLDDD SDENLDWIDD IFA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113091001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894890.0AC189489.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084K02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013699703.10.0PREDICTED: putative two-component response regulator-like APRR6
RefseqXP_013589599.10.0PREDICTED: putative two-component response regulator-like APRR6
TrEMBLA0A078EL660.0A0A078EL66_BRANA; BnaC06g29360D protein
STRINGBra004289.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.11e-113pseudo-response regulator 6
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]